PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family BBR-BPC
Protein Properties Length: 292aa    MW: 32770.1 Da    PI: 9.057
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35510genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind95.71.5e-2911391125
                  GAGA_bind   1 mdddgsrernkg.yye.........paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkal 74 
                                mdd  ++ r+k+ +y+         + ++ ++   +q+m+++aerda+i+ernla+sekkaa+aerdmaflqrd+a+aern+al
  Tp57577_TGAC_v2_mRNA35510   1 MDDR-ENGRHKAdQYKsaqgqwlmqQ-HQHQHPSMKQIMAIMAERDAAIQERNLAISEKKAALAERDMAFLQRDTAIAERNNAL 82 
                                6666.345999999998888888741.333334456************************************************ PP

                  GAGA_bind  75 verdnkllalllvensla.....salpvgvqvlsgtksidslqqlse.pqledsave 125
                                +erdn++++l+++en+la     s++p+g+q+++g+k+i++l q+++ p+++ +  +
  Tp57577_TGAC_v2_mRNA35510  83 MERDNAIATLQFRENALAxxxxmSSCPPGCQISRGVKHIHHLPQQQQtPKTTRKVKK 139
                                ****************99999999*****************9995443333333332 PP

2GAGA_bind267.85.7e-82133291163301
                  GAGA_bind 163 kakkkkkksekskkkvkkesader....................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWG 226
                                +++k+kk++e+ +k+  ++ +  +                    ska++k +d++ln+v++D+st+P+PvCsCtG+lrqCYkWG
  Tp57577_TGAC_v2_mRNA35510 133 TTRKVKKEGEDLNKTMFANDEALEwkssqeiinggddlnkqlpvSKADWKPQDFALNQVAYDDSTMPAPVCSCTGVLRQCYKWG 216
                                22233333333333333222222255566677777778888888**************************************** PP

                  GAGA_bind 227 nGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                                nGGWqSaCCtt++SvyPLP+++++r+aR++grKmS++af+klL++LaaeG+dls+pvDLkdhWAkHGtn+++ti+
  Tp57577_TGAC_v2_mRNA35510 217 NGGWQSACCTTNLSVYPLPAVPNKRHARVGGRKMSGSAFNKLLSRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK 291
                                **************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.8E-1461291IPR010409GAGA-binding transcriptional activator
PfamPF062173.2E-971291IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MDDRENGRHK ADQYKSAQGQ WLMQQHQHQH PSMKQIMAIM AERDAAIQER NLAISEKKAA  60
LAERDMAFLQ RDTAIAERNN ALMERDNAIA TLQFRENALA XXXXMSSCPP GCQISRGVKH  120
IHHLPQQQQT PKTTRKVKKE GEDLNKTMFA NDEALEWKSS QEIINGGDDL NKQLPVSKAD  180
WKPQDFALNQ VAYDDSTMPA PVCSCTGVLR QCYKWGNGGW QSACCTTNLS VYPLPAVPNK  240
RHARVGGRKM SGSAFNKLLS RLAAEGHDLS HPVDLKDHWA KHGTNRYITI K*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1242160.0AC124216.27 Medicago truncatula clone mth2-34o22, complete sequence.
GenBankAC1743150.0AC174315.4 Medicago truncatula clone mth2-165c4, complete sequence.
GenBankEF1020930.0EF102093.1 Medicago truncatula GAGA-binding transcriptional activator (BBR/BPC6) gene, complete cds.
GenBankEF1020940.0EF102094.1 Medicago truncatula GAGA-binding transcriptional activator (BBR/BPC6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589387.10.0GAGA-binding transcriptional activator BBR/BPC6-like protein
SwissprotQ8L9991e-116BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLG7I6G10.0G7I6G1_MEDTR; GAGA-binding transcriptional activator BBR/BPC6-like protein
STRINGGLYMA04G02860.11e-167(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-127basic pentacysteine 6